PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0104s0067.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 387aa    MW: 42761 Da    PI: 7.2656
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0104s0067.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.93.6e-31104157255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrW+p+LH +Fv av++LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Kalax.0104s0067.2.p 104 PRLRWSPDLHMCFVLAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRS 157
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-30100158IPR009057Homeodomain-like
PROSITE profilePS512949.904100160IPR017930Myb domain
SuperFamilySSF466891.36E-13102158IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-22104159IPR006447Myb domain, plants
PfamPF002491.5E-7105156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSTEKPTE AAIEIISGDE SYTSSSSRGA KDHSTTYKSS PTVLDLNERA TGGVQEEDDN  60
GDYCDDDDNE EGNSTSGNNE DRGGREIRSN GMNTVRQYVR SKMPRLRWSP DLHMCFVLAV  120
QRLGGQERAT PKLVLQLMNV KGLSIAHVKS HLQMYRSKKL DESGQVLSHH QNAPYSHGKH  180
HHQMMEIMCR RGVHTSSHPY AHPHFKMDSS RSGTCSLNNH VEFPSFRQSL SSTRNKNWPV  240
GSHGRWSEDL GLAPGCAPDH EPRASDVSKH FAGPVRQSHF LEKRWTASGL GLNAAYDWDK  300
KHPSDDHQMM KLNSVLSLWN PQTSSTTWSP TTSPTLTTAC LRFKEAVSDS SSPTPNLQLS  360
LGHADENETK PSDDASQRHA KGSSSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGVIT_12s0028g02080.t011e-44(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-36G2-like family protein